Structure of PDB 4yes Chain B Binding Site BS01

Receptor Information

>4yes Chain B (length=252) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
GE

Ligand information

>4yes Chain A (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GEADCGLRPLFEKKSLEDKTERELLESYI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4yes Improved Stability of Proline-Derived Direct Thrombin Inhibitors through Hydroxyl to Heterocycle Replacement.
Resolution	1.5 Å
Binding residue (original residue number in PDB)	E371 G373 M374 P376 W377 F474 D476 H479 P480 C482 Y497 K498 R500 N527 M574 K575 N580 R581 W582
Binding residue (residue number reindexed from 1)	E8 G10 M11 P13 W14 F111 D113 H116 P117 C119 Y134 K135 R137 N157 M204 K205 N210 R211 W212

Enzymatic activity

Catalytic site (original residue number in PDB)	H406 D462 E565 G566 D567 S568 G569
Catalytic site (residue number reindexed from 1)	H43 D99 E195 G196 D197 S198 G199
Enzyme Commision number	3.4.21.5: thrombin.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0005509	calcium ion binding

	Biological Process
GO:0006508	proteolysis
GO:0007596	blood coagulation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4yes, PDBe:4yes, PDBj:4yes
PDBsum	4yes
PubMed	26005532
UniProt	P00734\|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]