Structure of PDB 4y91 Chain B Binding Site BS01

Receptor Information
>4y91 Chain B (length=66) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQSLI
YKHAISTIIPSSYVML
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4y91 Crystal Structure of a Thermotoga maritima Hfq homolog
Resolution2.656 Å
Binding residue
(original residue number in PDB)
Q10 S43 Y44 H60
Binding residue
(residue number reindexed from 1)
Q3 S36 Y37 H53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0043487 regulation of RNA stability
GO:0045974 regulation of translation, ncRNA-mediated
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4y91, PDBe:4y91, PDBj:4y91
PDBsum4y91
PubMed
UniProtQ9WYZ6|HFQ_THEMA RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]