Structure of PDB 4y3u Chain B Binding Site BS01

Receptor Information
>4y3u Chain B (length=30) Species: 9615 (Canis lupus familiaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQQARQNLQNLFINFCLILICLLLICIIVM
Ligand information
>4y3u Chain C (length=16) Species: 9615 (Canis lupus familiaris) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4y3u The structural basis for phospholamban inhibition of the calcium pump in sarcoplasmic reticulum.
Resolution3.51 Å
Binding residue
(original residue number in PDB)		I40 I47
Binding residue
(residue number reindexed from 1)		I20 I27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042030 ATPase inhibitor activity
GO:0042803 protein homodimerization activity
Biological Process
GO:0001675 acrosome assembly
GO:0002026 regulation of the force of heart contraction
GO:0006874 intracellular calcium ion homeostasis
GO:0007219 Notch signaling pathway
GO:0007283 spermatogenesis
GO:0008016 regulation of heart contraction
GO:0008542 visual learning
GO:0010459 negative regulation of heart rate
GO:0010880 regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0010881 regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
GO:0032780 negative regulation of ATP-dependent activity
GO:0045475 locomotor rhythm
GO:0045822 negative regulation of heart contraction
GO:0046716 muscle cell cellular homeostasis
GO:0048738 cardiac muscle tissue development
GO:0050802 circadian sleep/wake cycle, sleep
GO:0051924 regulation of calcium ion transport
GO:0051926 negative regulation of calcium ion transport
GO:0086004 regulation of cardiac muscle cell contraction
GO:0086023 adenylate cyclase-activating adrenergic receptor signaling pathway involved in heart process
GO:0086092 regulation of the force of heart contraction by cardiac conduction
GO:0090279 regulation of calcium ion import
GO:1901020 negative regulation of calcium ion transmembrane transporter activity
GO:1901077 regulation of relaxation of muscle
GO:1901894 regulation of ATPase-coupled calcium transmembrane transporter activity
GO:1901895 negative regulation of ATPase-coupled calcium transmembrane transporter activity
GO:1902081 negative regulation of calcium ion import into sarcoplasmic reticulum
Cellular Component
GO:0005739 mitochondrion
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane
GO:0016529 sarcoplasmic reticulum
GO:0031966 mitochondrial membrane
GO:0033017 sarcoplasmic reticulum membrane
GO:0090534 calcium ion-transporting ATPase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4y3u, PDBe:4y3u, PDBj:4y3u
PDBsum4y3u
PubMed23996003
UniProtP61012|PPLA_CANLF Cardiac phospholamban (Gene Name=PLN)

[Back to BioLiP]