Structure of PDB 4xss Chain B Binding Site BS01

Receptor Information

>4xss Chain B (length=47) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ETLCGAELVDALQFVCGDRGFYFNTGIVDECCFRSCDLRRLEMYCAP

Ligand information

>4xss Chain F (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ENFLHNSIFVPR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4xss Structural Congruency of Ligand Binding to the Insulin and Insulin/Type 1 Insulin-like Growth Factor Hybrid Receptors.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	G7 V11 L14 F23 Y24 F25 G42 I43 V44 M59 Y60
Binding residue (residue number reindexed from 1)	G5 V9 L12 F21 Y22 F23 G26 I27 V28 M43 Y44

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005179	hormone activity
GO:0008083	growth factor activity

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:4xss, PDBe:4xss, PDBj:4xss
PDBsum	4xss
PubMed	26027733
UniProt	P05019\|IGF1_HUMAN Insulin-like growth factor I (Gene Name=IGF1)

[Back to BioLiP]