Structure of PDB 4xrs Chain B Binding Site BS01

Receptor Information
>4xrs Chain B (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARR
RIVQPMID
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xrs DNA-dependent formation of transcription factor pairs alters their binding specificity.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
I324 R327
Binding residue
(residue number reindexed from 1)
I46 R49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4xrs, PDBe:4xrs, PDBj:4xrs
PDBsum4xrs
PubMed26550823
UniProtO00470|MEIS1_HUMAN Homeobox protein Meis1 (Gene Name=MEIS1)

[Back to BioLiP]