Structure of PDB 4xrh Chain B Binding Site BS01

Receptor Information
>4xrh Chain B (length=247) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SESVPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLK
HYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRRGKATCGDV
DVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCR
LPGPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLS
EHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xrh Structural Mechanism for the Fidelity Modulation of DNA Polymerase lambda
Resolution3.0 Å
Binding residue
(original residue number in PDB)
W342 G343 G345 K347 T348 D427 D429 Y505 F506 T507 G508 A510 N513
Binding residue
(residue number reindexed from 1)
W14 G15 G17 K19 T20 D99 D101 Y177 F178 T179 G180 A182 N185
Enzymatic activity
Catalytic site (original residue number in PDB) D427 D429 D490
Catalytic site (residue number reindexed from 1) D99 D101 D162
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
4.2.99.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0016779 nucleotidyltransferase activity
GO:0034061 DNA polymerase activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4xrh, PDBe:4xrh, PDBj:4xrh
PDBsum4xrh
PubMed26836966
UniProtQ9UGP5|DPOLL_HUMAN DNA polymerase lambda (Gene Name=POLL)

[Back to BioLiP]