Structure of PDB 4xnh Chain B Binding Site BS01

Receptor Information
>4xnh Chain B (length=197) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PINIRRATINDIICMQNANLHNLPENYMMKYYMYHILSWPEASFVATTTT
LDCEDRTIKLDPTYLAPGEKLVGYVLVKMNDDPNEPPNGHITSLSVMRTY
RRMGIAENLMRQALFALREVHQAEYVSLHVRQSNRAALHLYRDTLAFEVL
SIEKSYYQDGEDAYAMKKVLKLEELQISNFTHRREKLEDDLESDLLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xnh Crystal structure of yeast N-terminal acetyltransferase NatE (IP6) in complex with a bisubstrate
Resolution2.1 Å
Binding residue
(original residue number in PDB)		E26 Y28 Y32 T116 Y180 Y181
Binding residue
(residue number reindexed from 1)		E25 Y27 Y31 T92 Y156 Y157
Enzymatic activity
Enzyme Commision number 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
Gene Ontology
Molecular Function
GO:0004596 peptide alpha-N-acetyltransferase activity
GO:0005515 protein binding
GO:0016746 acyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
GO:0042802 identical protein binding
GO:1990189 peptide-serine-alpha-N-acetyltransferase activity
GO:1990190 peptide-glutamate-alpha-N-acetyltransferase activity
Biological Process
GO:0006474 N-terminal protein amino acid acetylation
Cellular Component
GO:0005737 cytoplasm
GO:0031415 NatA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xnh, PDBe:4xnh, PDBj:4xnh
PDBsum4xnh
PubMed
UniProtP07347|ARD1_YEAST N-terminal acetyltransferase A complex catalytic subunit ARD1 (Gene Name=ARD1)

[Back to BioLiP]