Structure of PDB 4x3s Chain B Binding Site BS01

Receptor Information
>4x3s Chain B (length=60) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVM
AYEEKEERDR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4x3s Small-Molecule Modulators of Methyl-Lysine Binding for the CBX7 Chromodomain.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		M6 G7 E8 Q9 V10 F11 A12 V13 W32 W35 E43 H47 L49 D50
Binding residue
(residue number reindexed from 1)		M1 G2 E3 Q4 V5 F6 A7 V8 W27 W30 E38 H42 L44 D45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:4x3s, PDBe:4x3s, PDBj:4x3s
PDBsum4x3s
PubMed25660273
UniProtQ8VDS3|CBX7_MOUSE Chromobox protein homolog 7 (Gene Name=Cbx7)

[Back to BioLiP]