Structure of PDB 4wzs Chain B Binding Site BS01

Receptor Information
>4wzs Chain B (length=113) Species: 6035 (Encephalitozoon cuniculi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPKATVDKMVSSSVVPKESKEIFQNACIYFLNMLTLEANKACEEEKKKTI
SYEHVYKALKNLGFESYVESCMKEHENYESYIKQKDSGLTMEELHSQQIK
LFQNAKLQFERSF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wzs Structural basis for recognition and remodeling of the TBP:DNA:NC2 complex by Mot1.
Resolution3.78 Å
Binding residue
(original residue number in PDB)		A15 T16
Binding residue
(residue number reindexed from 1)		A4 T5
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017025 TBP-class protein binding
GO:0046982 protein heterodimerization activity
GO:0140223 general transcription initiation factor activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
Cellular Component
GO:0005634 nucleus
GO:0017054 negative cofactor 2 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wzs, PDBe:4wzs, PDBj:4wzs
PDBsum4wzs
PubMed26258880
UniProtM1K2J7

[Back to BioLiP]