Structure of PDB 4wvt Chain B Binding Site BS01

Receptor Information
>4wvt Chain B (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHMRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFA
CGGKLKNWEPGDRAWSEHRRHFPNCFFVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wvt The Discovery of Macrocyclic XIAP Antagonists from a DNA-Programmed Chemistry Library, and Their Optimization To Give Lead Compounds with in Vivo Antitumor Activity.
Resolution1.96 Å
Binding residue
(original residue number in PDB)
Q197 K206 L207 K208 W210 D214 E219 H223
Binding residue
(residue number reindexed from 1)
Q45 K54 L55 K56 W58 D62 E67 H71
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0043027 cysteine-type endopeptidase inhibitor activity involved in apoptotic process
Biological Process
GO:0043066 negative regulation of apoptotic process

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4wvt, PDBe:4wvt, PDBj:4wvt
PDBsum4wvt
PubMed25695766
UniProtP98170|XIAP_HUMAN E3 ubiquitin-protein ligase XIAP (Gene Name=XIAP)

[Back to BioLiP]