Structure of PDB 4wu4 Chain B Binding Site BS01

Receptor Information
>4wu4 Chain B (length=68) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVLHEDLTNREHEILMLIAQGKSNQEIADELFITLKTVKTHVSNILAKLD
VDNRTQAAIYAFQHGLAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wu4 A variable DNA recognition site organization establishes the LiaR-mediated cell envelope stress response of enterococci to daptomycin.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		N162 K174 K177 S181 N191 R192
Binding residue
(residue number reindexed from 1)		N24 K36 K39 S43 N53 R54
Binding affinityPDBbind-CN: Kd=0.39uM
External links