Structure of PDB 4wnl Chain B Binding Site BS01

Receptor Information
>4wnl Chain B (length=222) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTL
IKFVKKLRFYNDSVLSYNASEFINEPGADSFDKVILPIASMFVKCVETFD
LLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIES
LRIGSNLLDLEVVQFAIKSADEDGTDNIFLQEILPVNSEEEFQTLSAAWH
SILDGKLGALDEEFDVVATKWH
Ligand information
>4wnl Chain G (length=8) Species: 545124 (Saccharomyces cerevisiae AWRI1631) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PVLPGVKR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wnl Hooking She3p onto She2p for myosin-mediated cytoplasmic mRNA transport.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K153 W157 Q197 E198 I199 L200 W215 I218
Binding residue
(residue number reindexed from 1)		K142 W146 Q181 E182 I183 L184 W199 I202
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:1990825 sequence-specific mRNA binding
Biological Process
GO:0007533 mating type switching
GO:0008298 intracellular mRNA localization
GO:0051028 mRNA transport
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005934 cellular bud tip

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wnl, PDBe:4wnl, PDBj:4wnl
PDBsum4wnl
PubMed25535369
UniProtP36068|SHE2_YEAST SWI5-dependent HO expression protein 2 (Gene Name=SHE2)

[Back to BioLiP]