Structure of PDB 4wkr Chain B Binding Site BS01

Receptor Information
>4wkr Chain B (length=161) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRVKQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFN
KMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVY
VELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQ
AAKAIEFLNNP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wkr Structural insight into the mechanism of stabilization of the 7SK small nuclear RNA by LARP7.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Q41 F44 W45 D54 F56 L57 F77 N78 K79 H138 I154
Binding residue
(residue number reindexed from 1)		Q13 F16 W17 D26 F28 L29 F49 N50 K51 H110 I126
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006396 RNA processing
Cellular Component
GO:0005634 nucleus
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wkr, PDBe:4wkr, PDBj:4wkr
PDBsum4wkr
PubMed25753663
UniProtQ4G0J3|LARP7_HUMAN La-related protein 7 (Gene Name=LARP7)

[Back to BioLiP]