Structure of PDB 4wkm Chain B Binding Site BS01

Receptor Information

>4wkm Chain B (length=196) Species: 1006003 (Citrobacter freundii ATCC 8090 = MTCC 1658 = NBRC 12681) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EKLKIGVVGTFAIGCLFPLLSDFKRSYPHIDLHISTHNNRVDPAAEGLDY
TIRYGGGAWHDTDAQYLCSALMSPLCSPTLASQIQTPADILKFPLLRSYR
RDEWALWMQTVGEAPPSPTHNVMVFDSSVTMLEAAQAGMGVAIAPVRMFT
HLLSSERIVQPFLTQIDLGSYWITRLQSRPETPAMREFSRWLTGVL

Ligand information

>4wkm Chain J (length=5) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AEtAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4wkm The beta-Lactamase Gene Regulator AmpR Is a Tetramer That Recognizes and Binds the d-Ala-d-Ala Motif of Its Repressor UDP-N-acetylmuramic Acid (MurNAc)-pentapeptide.
Resolution	2.15 Å
Binding residue (original residue number in PDB)	T103 N131 N132 R133 Y147 S191 Y192 R193 D219 S220 S221 Y264
Binding residue (residue number reindexed from 1)	T10 N38 N39 R40 Y54 S98 Y99 R100 D126 S127 S128 Y171

External links

PDB	RCSB:4wkm, PDBe:4wkm, PDBj:4wkm
PDBsum	4wkm
PubMed	25480792

[Back to BioLiP]