Structure of PDB 4wcg Chain B Binding Site BS01

Receptor Information
>4wcg Chain B (length=61) Species: 180230 (Cyprinid herpesvirus 3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PISEEMNLKILAYLGTKQGAKAVHIAQSLGAQRSEVNRHLYRMSEDGRVR
KHPQHPVWYLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wcg The Structure of the Cyprinid herpesvirus 3 ORF112-Z alpha Z-DNA Complex Reveals a Mechanism of Nucleic Acids Recognition Conserved with E3L, a Poxvirus Inhibitor of Interferon Response.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		S250 N253 R254 Y257
Binding residue
(residue number reindexed from 1)		S34 N37 R38 Y41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003726 double-stranded RNA adenosine deaminase activity

View graph for
Molecular Function
External links
PDB RCSB:4wcg, PDBe:4wcg, PDBj:4wcg
PDBsum4wcg
PubMed26559969
UniProtA4FTK7

[Back to BioLiP]