Structure of PDB 4w92 Chain B Binding Site BS01

Receptor Information
>4w92 Chain B (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYATDSDIIAK
Ligand information
>4w92 Chain C (length=96) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcgcgcuuaaucugcagagcgggggacccauugcacucaggggugaaucc
ugguagggcgaaagcccgaauccgucagcuaaccucguaagcgcgc
<<<<<<<...<<<..>>><<<<<<....<...........<<<.....<<
.>>..<<<<....>>>>...>>>....>....>>>>>>.>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4w92 Crystal structure of a c-di-AMP riboswitch reveals an internally pseudo-dimeric RNA.
Resolution3.209 Å
Binding residue
(original residue number in PDB)
Y13 N15 N16 E19 L44 S48 L49 K50 M51 R52 Q54 F56 Y86 A87 T89 D90 S91 D92
Binding residue
(residue number reindexed from 1)
Y8 N10 N11 E14 L39 S43 L44 K45 M46 R47 Q49 F51 Y81 A82 T83 D84 S85 D86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4w92, PDBe:4w92, PDBj:4w92
PDBsum4w92
PubMed25271255
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]