Structure of PDB 4uzb Chain B Binding Site BS01

Receptor Information
>4uzb Chain B (length=137) Species: 37296 (Human gammaherpesvirus 8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHPRYQQPPVPYRQIDDCPAKARPQHIFYQQFLGKDGRRDPKCQWEFAVI
FWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNA
ATSKKVQMARLEWEASHPLAGNLQSSIVSFDDPLPLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4uzb The 3D Structure of Kaposi Sarcoma Herpesvirus Lana C-Terminal Domain Bound to DNA.
Resolution2.865 Å
Binding residue
(original residue number in PDB)		H1011 R1013 K1030 Y1066
Binding residue
(residue number reindexed from 1)		H2 R4 K21 Y57
Binding affinityPDBbind-CN: Kd=72nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4uzb, PDBe:4uzb, PDBj:4uzb
PDBsum4uzb
PubMed25947153
UniProtQ9QR71|LANA1_HHV8P Protein LANA1 (Gene Name=LANA1)

[Back to BioLiP]