Structure of PDB 4uyk Chain B Binding Site BS01

Receptor Information

>4uyk Chain B (length=90) Species: 9606 (Homo sapiens)

MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKEPADNKCL
LRATDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKR

Ligand information

>4uyk Chain R (length=134)

ggggcuaggccgggggguucggcguccccuguaaccggaaaccgccgaua
ugccggggccgaagcccgaggggcgguucccgaagccgccucuguaagga
ggcgguggaggguucccacccucgggcgugccuc

<<<<<..<<<<<<<<<<..(((((>>>>>>....<<<<....)))))...
..>>>>>>>>...<<<<<<<<<..<<..<<<...<<<<<<<<<....>>>
>>>>>>...>>>..>>..>>>>>>>>>..>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4uyk Crystal Structure of a Signal Recognition Particle Alu Domain in the Elongation Arrest Conformation.
• Resolution: 3.22 Å
• Binding residue (original residue number in PDB): M1 G24 S25 Y27 K31 Y33 R36 K38 R59 K64 K66
• Binding residue (residue number reindexed from 1): M1 G24 S25 Y27 K31 Y33 R36 K38 R52 K57 K59

Gene Ontology

Molecular Function

• GO:0008312 7S RNA binding
• GO:0030942 endoplasmic reticulum signal peptide binding

Biological Process

• GO:0006614 SRP-dependent cotranslational protein targeting to membrane

Cellular Component

• GO:0005786 signal recognition particle, endoplasmic reticulum targeting
• GO:0048500 signal recognition particle

External links

• PDB: RCSB:4uyk, PDBe:4uyk, PDBj:4uyk
• PDBsum: 4uyk
• PubMed: 25336584
• UniProt: P37108|SRP14_HUMAN Signal recognition particle 14 kDa protein (Gene Name=SRP14)