Structure of PDB 4uwx Chain B Binding Site BS01

Receptor Information
>4uwx Chain B (length=230) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAMMYIQELRSGLRDMHLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD
ILKRLHDEKNYDSRNQHEIIRCLKAFMNNKFGIKTMLETEEGILLLVRAM
DPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPL
LDGLKSGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQ
ELREIENEDMKVQLCVFDEQGDEDFFDLKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4uwx Structural and Biochemical Basis for the Inhibitory Effect of Liprin-Alpha3 on Mouse Diaphanous 1 (Mdia1) Function.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		K252 I259 Q307 N310 A311 T314 P315 A316 V355 E358 Q359 E362
Binding residue
(residue number reindexed from 1)		K113 I120 Q168 N171 A172 T175 P176 A177 V216 E219 Q220 E223
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0031267 small GTPase binding
Biological Process
GO:0016043 cellular component organization
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4uwx, PDBe:4uwx, PDBj:4uwx
PDBsum4uwx
PubMed25911102
UniProtO08808|DIAP1_MOUSE Protein diaphanous homolog 1 (Gene Name=Diaph1)

[Back to BioLiP]