Structure of PDB 4uus Chain B Binding Site BS01

Receptor Information
>4uus Chain B (length=69) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKR
IRYKKNIGKAQEEANLYAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4uus A Flexible Extension of the Drosophila Ultrabithorax Homeodomain Defines a Novel Hox/Pbc Interaction Mode.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		Y25 R53 I54
Binding residue
(residue number reindexed from 1)		Y22 R50 I51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4uus, PDBe:4uus, PDBj:4uus
PDBsum4uus
PubMed25651060
UniProtP40427|EXD_DROME Homeobox protein extradenticle (Gene Name=exd)

[Back to BioLiP]