Structure of PDB 4une Chain B Binding Site BS01

Receptor Information
>4une Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFFTPKT
Ligand information
>4une Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4une Human Insulin Analogues Modified at the B26 Site Reveal a Hormone Conformation that is Undetected in the Receptor Complex
Resolution1.59 Å
Binding residue
(original residue number in PDB)		H5 L6 C7 V18 C19 R22 G23 F24
Binding residue
(residue number reindexed from 1)		H5 L6 C7 V18 C19 R22 G23 F24
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4une, PDBe:4une, PDBj:4une
PDBsum4une
PubMed25286859
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]