Structure of PDB 4u8t Chain B Binding Site BS01

Receptor Information
>4u8t Chain B (length=154) Species: 559307 (Zygosaccharomyces rouxii CBS 732) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAIIPPWIHVPDHSRFFVIKSSSLEHVKKSFYNGIWSSTFYGNKRLSEAY
ESLPQGAKIYLLFSVNASGRFCGVAEMSSNLREDLDTSIWGYRHAFKVRW
IVVRDVHNRSLKQFLIPANDMKPVTNSRDTQEIPATISKSILKLFKYVQS
FLDD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4u8t Molecular basis for the recognition of methylated adenines in RNA by the eukaryotic YTH domain.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		K184 S185 S186 H190 W200 S201 T203 Y205 R209 N230 A231 W254 Y260 N276 T293 N294 S295 R296 D297
Binding residue
(residue number reindexed from 1)		K20 S21 S22 H26 W36 S37 T39 Y41 R45 N66 A67 W90 Y92 N108 T125 N126 S127 R128 D129
Binding affinityPDBbind-CN: Kd=0.2uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4u8t, PDBe:4u8t, PDBj:4u8t
PDBsum4u8t
PubMed25201973
UniProtC5E1V0

[Back to BioLiP]