Structure of PDB 4u7e Chain B Binding Site BS01

Receptor Information
>4u7e Chain B (length=163) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKI
DSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFL
YADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKA
TYIHNCLKNGETP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4u7e Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		L40 Q44 M47 S51 K52 M64 L67 E68 K71
Binding residue
(residue number reindexed from 1)		L41 Q45 M48 S52 K53 M65 L68 E69 K72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0032511 late endosome to vacuole transport via multivesicular body sorting pathway

View graph for
Biological Process
External links
PDB RCSB:4u7e, PDBe:4u7e, PDBj:4u7e
PDBsum4u7e
PubMed25657007
UniProtQ9NP79|VTA1_HUMAN Vacuolar protein sorting-associated protein VTA1 homolog (Gene Name=VTA1)

[Back to BioLiP]