Structure of PDB 4u0y Chain B Binding Site BS01

Receptor Information
>4u0y Chain B (length=75) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMT
VRQALSNLVNEGLLYRLKGRGTFVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4u0y Structural insight into operator dre-sites recognition and effector binding in the GntR/HutC transcription regulator NagR.
Resolution1.91 Å
Binding residue
(original residue number in PDB)		P10 I11 Y12 S47 T50
Binding residue
(residue number reindexed from 1)		P10 I11 Y12 S47 T50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4u0y, PDBe:4u0y, PDBj:4u0y
PDBsum4u0y
PubMed25564531
UniProtO34817|NAGR_BACSU HTH-type transcriptional repressor NagR (Gene Name=nagR)

[Back to BioLiP]