Structure of PDB 4tzn Chain B Binding Site BS01

Receptor Information
>4tzn Chain B (length=232) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAIDDKTWSKLFPSIVSDPDRSSNFMIRAIYVVFSAVLRQRNILEKEYFS
KNYITENLSCMTLSFKNLRAHQIAQLLRAAGDATKDGFLKEISLVVTEHD
GDVEAIEVFSMKFIYFENGGVVARLSTDQEDPHFAELAQLRYEGAESVRD
QMVTIVRSVQFLCTKVLEPLPAEFTANFRLKYTNDAPSNFRIDGFDDSST
FYTLPDGIQSVTIGHLRPGHHAAHMQCWSKSM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tzn The Chromosome Axis Controls Meiotic Events through a Hierarchical Assembly of HORMA Domain Proteins.
Resolution3.115 Å
Binding residue
(original residue number in PDB)		R85 T194 A195 N196 F197 R198 L199 K200 Y201 F209 R210 F214 D215 D216 S217 T219 F220
Binding residue
(residue number reindexed from 1)		R69 T175 A176 N177 F178 R179 L180 K181 Y182 F190 R191 F195 D196 D197 S198 T200 F201
Enzymatic activity
Enzyme Commision number ?
External links