Structure of PDB 4tzl Chain B Binding Site BS01

Receptor Information
>4tzl Chain B (length=226) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAIDDKTWSKLFPSIVSDPDRSSNFMIRAIYVVFSAVLRQRNILEKEYFS
KNYITENLSCMTLSFKNLRAHQIAQLLRAAGDATKDGFLKEISLVVTEHD
GDVEAIEVFSMKFIYFENGGVVARLPHFAELAQLRYEGAESVRDQMVTIV
RSVQFLCTKVLEPLPAEFTANFRLKYTNDAPSNFRIDGFDDSSTFYTLPD
GIQSVTIGHLRPGHHAAHMQCWSKSM
Ligand information
>4tzl Chain D (length=16) Species: 6239 (Caenorhabditis elegans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARDSPYGLSQGITKKN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tzl The Chromosome Axis Controls Meiotic Events through a Hierarchical Assembly of HORMA Domain Proteins.
Resolution2.537 Å
Binding residue
(original residue number in PDB)		E192 F193 T194 A195 N196 F197 R198 L199 K200 Y201 S207 F209 R210 F214 D215 D216 S217 S218 F220
Binding residue
(residue number reindexed from 1)		E167 F168 T169 A170 N171 F172 R173 L174 K175 Y176 S182 F184 R185 F189 D190 D191 S192 S193 F195
Enzymatic activity
Enzyme Commision number ?
External links