Structure of PDB 4txq Chain B Binding Site BS01

Receptor Information
>4txq Chain B (length=162) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKID
SKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLY
ADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKAT
YIHNCLKNGETP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4txq A Novel Mechanism of Regulating the ATPase VPS4 by Its Cofactor LIP5 and the Endosomal Sorting Complex Required for Transport (ESCRT)-III Protein CHMP5.
Resolution2.21 Å
Binding residue
(original residue number in PDB)		Y36 L40 M47 S51 M64 L67 E68 K71 V130
Binding residue
(residue number reindexed from 1)		Y36 L40 M47 S51 M64 L67 E68 K71 V130
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0032511 late endosome to vacuole transport via multivesicular body sorting pathway

View graph for
Biological Process
External links
PDB RCSB:4txq, PDBe:4txq, PDBj:4txq
PDBsum4txq
PubMed25637630
UniProtQ9NP79|VTA1_HUMAN Vacuolar protein sorting-associated protein VTA1 homolog (Gene Name=VTA1)

[Back to BioLiP]