Structure of PDB 4tux Chain B Binding Site BS01

Receptor Information
>4tux Chain B (length=67) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYTEADPAILSRRQKQIDYGKNTAAYERYVEMVPKDEHPRTPNKYGKYSR
RAFDGLVKIWRKSLHIY
Ligand information
>4tux Chain D (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggccaaaggcccuuuucagggccacc
.......<<<<<<....>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tux Molecular mechanisms for the regulation of histone mRNA stem-loop-binding protein by phosphorylation.
Resolution3.08 Å
Binding residue
(original residue number in PDB)		R197 Y204 N207 Y237 S238 R239 R240 A241 L245 K247 I248 R250 K251 H254
Binding residue
(residue number reindexed from 1)		R12 Y19 N22 Y48 S49 R50 R51 A52 L56 K58 I59 R61 K62 H65
Binding affinityPDBbind-CN: Kd=46.1nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding

View graph for
Molecular Function
External links
PDB RCSB:4tux, PDBe:4tux, PDBj:4tux
PDBsum4tux
PubMed25002523
UniProtQ9VAN6|SLBP_DROME Histone RNA hairpin-binding protein (Gene Name=Slbp)

[Back to BioLiP]