Structure of PDB 4tu8 Chain B Binding Site BS01

Receptor Information
>4tu8 Chain B (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQIN
QDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLF
IGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINV
TDQAIAGLNGMQLGDKKLLVQRAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tu8 Structure-guided U2AF65 variant improves recognition and splicing of a defective pre-mRNA.
Resolution1.918 Å
Binding residue
(original residue number in PDB)		K260 F262 G264 G265 S294 K300 Y302 F304 K328 K329 L331 Q333 A335
Binding residue
(residue number reindexed from 1)		K98 F100 G102 G103 S132 K138 Y140 F142 K166 K167 L169 Q171 A173
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4tu8, PDBe:4tu8, PDBj:4tu8
PDBsum4tu8
PubMed25422459
UniProtP26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit (Gene Name=U2AF2)

[Back to BioLiP]