Structure of PDB 4tnt Chain B Binding Site BS01

Receptor Information
>4tnt Chain B (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRLQKCLQAGMNLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tnt Crystal structure of the mineralocorticoid receptor DNA binding domain in complex with DNA.
Resolution2.3938 Å
Binding residue
(original residue number in PDB)		G621 S622 R629 R652 K653 R659
Binding residue
(residue number reindexed from 1)		G22 S23 R30 R53 K54 R60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4tnt, PDBe:4tnt, PDBj:4tnt
PDBsum4tnt
PubMed25188500
UniProtP08235|MCR_HUMAN Mineralocorticoid receptor (Gene Name=NR3C2)

[Back to BioLiP]