Structure of PDB 4tkn Chain B Binding Site BS01

Receptor Information
>4tkn Chain B (length=247) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSL
FLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDD
DVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRL
AQTLRHYGYLRFDACVADVVVSAGNSELSLQLEGSFRVTRMRCWRVTSSV
PLVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tkn Structural Determinants for Binding of Sorting Nexin 17 (SNX17) to the Cytoplasmic Adaptor Protein Krev Interaction Trapped 1 (KRIT1).
Resolution3.0 Å
Binding residue
(original residue number in PDB)		T316 M318 R319 C320 W321 L353 V380 L383 M384
Binding residue
(residue number reindexed from 1)		T189 M191 R192 C193 W194 L212 V239 L242 M243
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035091 phosphatidylinositol binding
Biological Process
GO:0006886 intracellular protein transport
GO:0007165 signal transduction
Cellular Component
GO:0005856 cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4tkn, PDBe:4tkn, PDBj:4tkn
PDBsum4tkn
PubMed25059659
UniProtQ15036|SNX17_HUMAN Sorting nexin-17 (Gene Name=SNX17)

[Back to BioLiP]