Structure of PDB 4s15 Chain B Binding Site BS01

Receptor Information

>4s15 Chain B (length=250) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SMAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREV
MWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRM
CRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTED
EIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILT
KLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPA

Ligand information

>4s15 Chain D (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TLLQLLLGH

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4s15 Identification of Natural ROR gamma Ligands that Regulate the Development of Lymphoid Cells.
Resolution	1.897 Å
Binding residue (original residue number in PDB)	K339 Q349 Q352 E509
Binding residue (residue number reindexed from 1)	K71 Q81 Q84 E241

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4s15, PDBe:4s15, PDBj:4s15
PDBsum	4s15
PubMed	25651181
UniProt	P35398\|RORA_HUMAN Nuclear receptor ROR-alpha (Gene Name=RORA)

[Back to BioLiP]