Structure of PDB 4s05 Chain B Binding Site BS01

Receptor Information
>4s05 Chain B (length=219) Species: 1380908 (Klebsiella pneumoniae JM45) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVL
DLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLV
KPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDL
TPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREK
IGKSRIRTVRGFGYMLANN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4s05 Structure and dynamics of polymyxin-resistance-associated response regulator PmrA in complex with promoter DNA.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		T151 K153 Y179 P185 T187 N188 T189 H193 R210
Binding residue
(residue number reindexed from 1)		T151 K153 Y179 P185 T187 N188 T189 H193 R210
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000156 phosphorelay response regulator activity
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4s05, PDBe:4s05, PDBj:4s05
PDBsum4s05
PubMed26564787
UniProtA0A0R4I965

[Back to BioLiP]