Structure of PDB 4rdm Chain B Binding Site BS01

Receptor Information
>4rdm Chain B (length=164) Species: 242231 (Neisseria gonorrhoeae FA 1090) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LENCLGVQKIAPEQIRQLFAQTSEYHFSIPAKTEEKSNLNVFFGEGRRDK
RGFVKPRPWYEVELIVSKDITSQEGYPVLKSFTVITDDGWQFQCKTSGDY
SKNFRSENDLKTLGKWIKGRLESHGCLQNNEKITHETLREYGNDHFELRS
TDNPDVWLLSFKGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rdm Crystal structure of the R-protein of the multisubunit ATP-dependent restriction endonuclease NgoAVII.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
R227 S277 G278 D279 K282 N283 R285 N288 L290
Binding residue
(residue number reindexed from 1)
R47 S97 G98 D99 K102 N103 R105 N108 L110
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
External links