Structure of PDB 4rcm Chain B Binding Site BS01

Receptor Information
>4rcm Chain B (length=159) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAIIPPWLNIPENSRFFVIKSSSLKHVKRSFYNGIWSSTHFGNKRLSEAY
KKLNSGAKVFLFFSINTSGRFCGVAEMVSDLKMDLDTSIWEDEQKYGKAF
KVRWVIVRDINNRSLKRFLIPSNEMKPITHSRDTQEIPYSIGISIINLFK
TQDIFSFLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rcm Structural Basis for the Discriminative Recognition of N6-Methyladenosine RNA by the Human YT521-B Homology Domain Family of Proteins.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K161 S163 H167 W177 S178 T180 W231 Y237 D274
Binding residue
(residue number reindexed from 1)		K20 S22 H26 W36 S37 T39 W90 Y96 D133
Binding affinityPDBbind-CN: Kd=22uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4rcm, PDBe:4rcm, PDBj:4rcm
PDBsum4rcm
PubMed26318451
UniProtQ06390|MRB1_YEAST Methylated RNA-binding protein 1 (Gene Name=PHO92)

[Back to BioLiP]