Structure of PDB 4rav Chain B Binding Site BS01

Receptor Information
>4rav Chain B (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSALTQPASVSGSPGQSITISCTGTSSDIGAYNYVSWYQQYPGKAPKLLI
YDVSNRPSGISNRFSGSKSGDTASLTISGLQAEDEADYYCSSFANSGPLF
GGGTKVTVLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rav Structure of a single-chain fv bound to the 17 N-terminal residues of huntingtin provides insights into pathogenic amyloid formation and suppression.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		F220 N222 G224
Binding residue
(residue number reindexed from 1)		F93 N95 G97
External links