Structure of PDB 4r56 Chain B Binding Site BS01

Receptor Information
>4r56 Chain B (length=59) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFR
HKLPDDYPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r56 Insights into the interaction between Cren7 and DNA: the role of loop beta 3-beta 4
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K24 W26 L28 A29 P30 K31 L40 Y49 R51
Binding residue
(residue number reindexed from 1)		K23 W25 L27 A28 P29 K30 L39 Y48 R50
Binding affinityPDBbind-CN: Kd=0.134uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4r56, PDBe:4r56, PDBj:4r56
PDBsum4r56
PubMed25555709
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]