Structure of PDB 4r4e Chain B Binding Site BS01

Receptor Information

>4r4e Chain B (length=84) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MSDNIRRSMPLFPIGIVMQLTELSARQIRYYEENGLIFPARTEGNRRLFS
FHDVDKLLEIKHLIEQGVNMAGIKQILAKAEAEP

Ligand information

>4r4e Chain D (length=9) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

attctgaca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4r4e Structures of regulatory machinery reveal novel molecular mechanisms controlling B. subtilis nitrogen homeostasis.
Resolution	2.57 Å
Binding residue (original residue number in PDB)	G15 R26 R29 R41 N45 R46 R47
Binding residue (residue number reindexed from 1)	G15 R26 R29 R41 N45 R46 R47
Binding affinity	PDBbind-CN: Kd=8.1nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4r4e, PDBe:4r4e, PDBj:4r4e
PDBsum	4r4e
PubMed	25691471
UniProt	P37582\|GLNR_BACSU HTH-type transcriptional regulator GlnR (Gene Name=glnR)

[Back to BioLiP]