Structure of PDB 4r3s Chain B Binding Site BS01

Receptor Information
>4r3s Chain B (length=111) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVLTQSPASLAVSLGQRATISCKASQSVDHDGDSYMNWFQQKPGQSPKL
LIYAASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQTNEDPY
TFGGGTKLEIK
Ligand information
>4r3s Chain Q (length=12) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
INNAYNMSIRRS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r3s Structural basis for epitope masking and strain specificity of a conserved epitope in an intrinsically disordered malaria vaccine candidate
Resolution1.7 Å
Binding residue
(original residue number in PDB)		H31 Y36 Y53 N57 T95 N96 Y100
Binding residue
(residue number reindexed from 1)		H31 Y36 Y53 N57 T95 N96 Y100
External links