Structure of PDB 4r22 Chain B Binding Site BS01

Receptor Information

>4r22 Chain B (length=82) Species: 1006007 (Priestia megaterium WSH-002) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SYRDKKVMSIGIVKELTGLSERQIRYYEKRSLLFPDRTNTGIRKYSFSDV
ERLMDIADRIEEGVQTSEIRTELAKKDEARKM

Ligand information

>4r22 Chain G (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgtgtaaggaattctgacacg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4r22 Structures of regulatory machinery reveal novel molecular mechanisms controlling B. subtilis nitrogen homeostasis.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	S15 I16 G17 R28 R31 R43 R49
Binding residue (residue number reindexed from 1)	S9 I10 G11 R22 R25 R37 R43
Binding affinity	PDBbind-CN: Kd=11.6nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4r22, PDBe:4r22, PDBj:4r22
PDBsum	4r22
PubMed	25691471
UniProt	G2RUZ1\|TNRA_PRIMW HTH-type transcriptional regulator TnrA (Gene Name=tnrA)

[Back to BioLiP]