Structure of PDB 4qxt Chain B Binding Site BS01

Receptor Information
>4qxt Chain B (length=111) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVLTQSPASLAVSLGQRATISCKASQSVDHDGDSYMNWFQQKPGQSPKL
LIYAASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQTNEDPY
TFGGGTKLEIK
Ligand information
>4qxt Chain Q (length=10) Species: 5839 (Plasmodium falciparum K1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NAYNMSIRRS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qxt Structural basis for epitope masking and strain specificity of a conserved epitope in an intrinsically disordered malaria vaccine candidate.
Resolution1.58 Å
Binding residue
(original residue number in PDB)		H31 D34 Y36 N38 Y53 E59 S60 T95 N96 Y100
Binding residue
(residue number reindexed from 1)		H31 D34 Y36 N38 Y53 E59 S60 T95 N96 Y100
External links