Structure of PDB 4qtk Chain B Binding Site BS01

Receptor Information
>4qtk Chain B (length=148) Species: 237561 (Candida albicans SC5314) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVPTYNGYIHNTRDALAVIQQVLDKQLEPVSRRPHERERGVLIVSGSVFV
FIEQSSGIKRWTDGISWSPSRIQGRFLVYGELNGLVKKTITLTTTTKELH
MEGKAEKQTIHLISYYSKQDIDSGKLQRPSESDLKHVQISPALWTMVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qtk Crystal structure of the WOPR-DNA complex and implications for Wor1 function in white-opaque switching of Candida albicans.
Resolution2.99 Å
Binding residue
(original residue number in PDB)
R38 K64 R65 T67 R76
Binding residue
(residue number reindexed from 1)
R33 K59 R60 T62 R71
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4qtk, PDBe:4qtk, PDBj:4qtk
PDBsum4qtk
PubMed25091450
UniProtQ5AP80|WOR1_CANAL White-opaque regulator 1 (Gene Name=WOR1)

[Back to BioLiP]