Structure of PDB 4qq4 Chain B Binding Site BS01

Receptor Information

>4qq4 Chain B (length=48) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPE

Ligand information

>4qq4 Chain D (length=8) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ARTKQTAR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4qq4 Family-wide Characterization of Histone Binding Abilities of Human CW Domain-containing Proteins.
Resolution	1.75 Å
Binding residue (original residue number in PDB)	P406 D407 Q408 T409 W410 V411 Q412 W419 D424 P430 E431
Binding residue (residue number reindexed from 1)	P1 D2 Q3 T4 W5 V6 Q7 W14 D19 P25 E26

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0008270	zinc ion binding

View graph for
Molecular Function

External links

PDB	RCSB:4qq4, PDBe:4qq4, PDBj:4qq4
PDBsum	4qq4
PubMed	26933034
UniProt	Q14149\|MORC3_HUMAN MORC family CW-type zinc finger protein 3 (Gene Name=MORC3)

[Back to BioLiP]