Structure of PDB 4qmf Chain B Binding Site BS01

Receptor Information
>4qmf Chain B (length=175) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESSFMTLFPKYRESYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRK
TYDPAIILKARDLIKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKER
FVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVV
EDCMKNIHPIYHIKELMIKRELAKR
Ligand information
>4qmf Chain A (length=20) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PEAENLQNDLELQQFLRESH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qmf Interaction between ribosome assembly factors Krr1 and Faf1 is essential for formation of small ribosomal subunit in yeast
Resolution2.804 Å
Binding residue
(original residue number in PDB)		R144 T152 N193 H195 I197 K201 M204
Binding residue
(residue number reindexed from 1)		R107 T115 N156 H158 I160 K164 M167
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4qmf, PDBe:4qmf, PDBj:4qmf
PDBsum4qmf
PubMed24990943
UniProtP25586|KRR1_YEAST KRR1 small subunit processome component (Gene Name=KRR1)

[Back to BioLiP]