Structure of PDB 4qgu Chain B Binding Site BS01

Receptor Information

>4qgu Chain B (length=191) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NVLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNT
SLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPQTFEVPNKIINRA
KETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGT
GQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIK

Ligand information

>4qgu Chain C (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aggccggcgtga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4qgu New insights into the structural basis of DNA recognition by HINa and HINb domains of IFI16.
Resolution	2.545 Å
Binding residue (original residue number in PDB)	S312 R370 K371 N373 Q374
Binding residue (residue number reindexed from 1)	S114 R172 K173 N175 Q176

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0002218	activation of innate immune response
GO:0035458	cellular response to interferon-beta

View graph for
Biological Process

External links

PDB	RCSB:4qgu, PDBe:4qgu, PDBj:4qgu
PDBsum	4qgu
PubMed	26246511
UniProt	Q16666\|IF16_HUMAN Gamma-interferon-inducible protein 16 (Gene Name=IFI16)

[Back to BioLiP]