Structure of PDB 4qc1 Chain B Binding Site BS01

Receptor Information
>4qc1 Chain B (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTI
REKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKK
WTDTFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qc1 Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
Resolution1.99 Å
Binding residue
(original residue number in PDB)
V2089 E2137 T2138 F2139 N2140 E2141 S2144 I2146
Binding residue
(residue number reindexed from 1)
V29 E77 T78 F79 N80 E81 S84 I86
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4qc1, PDBe:4qc1, PDBj:4qc1
PDBsum4qc1
PubMed25533489
UniProtQ9UIF8|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B (Gene Name=BAZ2B)

[Back to BioLiP]