Structure of PDB 4qbm Chain B Binding Site BS01

Receptor Information
>4qbm Chain B (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMHSDLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTM
RERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHIMRRFFESR
WEEFY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qbm Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
Resolution1.65 Å
Binding residue
(original residue number in PDB)
W1816 L1826
Binding residue
(residue number reindexed from 1)
W23 L33
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4qbm, PDBe:4qbm, PDBj:4qbm
PDBsum4qbm
PubMed25533489
UniProtQ9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A (Gene Name=BAZ2A)

[Back to BioLiP]