Structure of PDB 4q94 Chain B Binding Site BS01

Receptor Information
>4q94 Chain B (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKA
KSNRKLTFLYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCK
KPLERLLNIWQERSVYGGEFIQQLKLSME
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4q94 RPRD1A and RPRD1B are human RNA polymerase II C-terminal domain scaffolds for Ser5 dephosphorylation.
Resolution1.85 Å
Binding residue
(original residue number in PDB)
R106 I110 R114
Binding residue
(residue number reindexed from 1)
R105 I109 R113
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4q94, PDBe:4q94, PDBj:4q94
PDBsum4q94
PubMed24997600
UniProtQ9NQG5|RPR1B_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1B (Gene Name=RPRD1B)

[Back to BioLiP]