Structure of PDB 4q6s Chain B Binding Site BS01

Receptor Information
>4q6s Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVG
DAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4q6s Modulator Preferences are Critical Co-Determinants of PDZ Network Wiring
Resolution1.45 Å
Binding residue
(original residue number in PDB)		G298 L299 I301 S302 I303 T304 H309 P312 H349 V353 V370
Binding residue
(residue number reindexed from 1)		G15 L16 I18 S19 I20 T21 H26 P29 H66 V70 V87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005794 Golgi apparatus

View graph for
Cellular Component
External links
PDB RCSB:4q6s, PDBe:4q6s, PDBj:4q6s
PDBsum4q6s
PubMed
UniProtQ9HD26|GOPC_HUMAN Golgi-associated PDZ and coiled-coil motif-containing protein (Gene Name=GOPC)

[Back to BioLiP]