Structure of PDB 4q6f Chain B Binding Site BS01

Receptor Information
>4q6f Chain B (length=54) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCL
AQQV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4q6f Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
Resolution1.91 Å
Binding residue
(original residue number in PDB)		V1677 D1688 E1689 L1691 L1692 L1693 D1695 V1713 P1714 E1715 G1716
Binding residue
(residue number reindexed from 1)		V3 D14 E15 L17 L18 L19 D21 V39 P40 E41 G42
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4q6f, PDBe:4q6f, PDBj:4q6f
PDBsum4q6f
PubMed25533489
UniProtQ9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A (Gene Name=BAZ2A)

[Back to BioLiP]